ACCN2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ACCN2 Antibody [NBP2-58458] - Staining of human cell line U-2 OS shows localization to plasma membrane & the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACCN2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFT
Specificity
Specificity of human ACCN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASIC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACCN2 Recombinant Protein Antigen (NBP2-58458PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ACCN2 Antibody

  • Acid-sensing ion channel 1
  • acid-sensing ion channel 1a protein
  • amiloride-sensitive cation channel 2, neuronal
  • ASIC
  • ASIC1ASIC1A
  • BNAC2
  • BNaC2ACCN2 variant 3
  • Brain sodium channel 2
  • Cation channel, amiloride-sensitive, neuronal, 2
  • hBNaC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14321
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46288
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1617
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-41403
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-15241
Species: Hu
Applications: WB
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB110-40763
Species: Hu, Mu, Rt, Gp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP3-05565
Species: Hu, Rt
Applications: WB
NBP1-86724
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58458
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ACCN2 Antibody (NBP2-58458) (0)

There are no publications for ACCN2 Antibody (NBP2-58458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACCN2 Antibody (NBP2-58458) (0)

There are no reviews for ACCN2 Antibody (NBP2-58458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ACCN2 Antibody (NBP2-58458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACCN2 Products

Bioinformatics Tool for ACCN2 Antibody (NBP2-58458)

Discover related pathways, diseases and genes to ACCN2 Antibody (NBP2-58458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACCN2 Antibody (NBP2-58458)

Discover more about diseases related to ACCN2 Antibody (NBP2-58458).
 

Pathways for ACCN2 Antibody (NBP2-58458)

View related products by pathway.

PTMs for ACCN2 Antibody (NBP2-58458)

Learn more about PTMs related to ACCN2 Antibody (NBP2-58458).

Blogs on ACCN2

There are no specific blogs for ACCN2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACCN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASIC1