ACADVL Antibody (5D3) - Azide and BSA Free

Western Blot: ACADVL Antibody (5D3) [H00000037-M01] - ACADVL monoclonal antibody (M01), clone 5D3 Analysis of ACADVL expression in Hela S3 NE.

Immunohistochemistry-Paraffin: ACADVL Antibody (5D3) [H00000037-M01] - Analysis of monoclonal antibody to ACADVL on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.

Western Blot: ACADVL Antibody (5D3) [H00000037-M01] - Alcohol feeding showed no significant effect on the expression of ACADVL in mouse liver. Image from verified customer review.

ELISA: ACADVL Antibody (5D3) [H00000037-M01] - Detection limit for recombinant GST tagged ACADVL is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clone: 5D3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ACADVL Antibody (5D3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ACADVL (NP_000009, 345 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI
• Specificity: ACADVL - acyl-Coenzyme A dehydrogenase, very long chain
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ACADVL
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACADVL Antibody (5D3) - Azide and BSA Free

• ACAD6
• acyl-CoA dehydrogenase, very long chain
• acyl-Coenzyme A dehydrogenase, very long chain
• EC 1.3.99
• EC 1.3.99.-
• LCACD
• very long-chain specific acyl-CoA dehydrogenase, mitochondrial
• VLCAD

Background

The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ACADVL Antibody (H00000037-M01)(2)

Publications using H00000037-M01

• Nouws J, Te Brinke H, Nijtmans LG, Houten SM. ACAD9, a complex I assembly factor with a moonlighting function in fatty acid oxidation deficiencies. Hum Mol Genet. 2013-11-06 [PMID: 24158852]
• De Pauw A, Demine S, Tejerina S et al. Mild mitochondrial uncoupling does not affect mitochondrial biogenesis but downregulates pyruvate carboxylase in adipocytes: role for triglyceride content reduction. Am J Physiol Endocrinol Metab. 2012-02-21 [PMID: 22354779]

Review for ACADVL Antibody (H00000037-M01) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer WB Mouse 03/26/2018

Summary

• Application: Western Blot
• Sample Tested: Liver
• Species: Mouse
• Lot: 6335-5d3-00acy6

Bioinformatics

• Gene Symbol: ACADVL
• Entrez:
  • 37(Human)
• OMIM:
  • 201475(Human)
• Uniprot:
  • NP_000009(Human)