ACADVL Antibody (5D3)

Images

 
Western Blot: ACADVL Antibody (5D3) [H00000037-M01] - Alcohol feeding showed no significant effect on the expression of ACADVL in mouse liver. Image from verified customer review.
Immunohistochemistry-Paraffin: ACADVL Antibody (5D3) [H00000037-M01] - Analysis of monoclonal antibody to ACADVL on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.
Western Blot: ACADVL Antibody (5D3) [H00000037-M01] - Western Blot analysis of ACADVL expression in Hela NE ( Cat # L013V3 ).
Western Blot: ACADVL Antibody (5D3) [H00000037-M01] - ACADVL monoclonal antibody (M01), clone 5D3 Analysis of ACADVL expression in Hela S3 NE.
Sandwich ELISA: ACADVL Antibody (5D3) [H00000037-M01] - Detection limit for recombinant GST tagged ACADVL is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
5D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ACADVL Antibody (5D3) Summary

Immunogen
ACADVL (NP_000009, 345 a.a. - 434 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI
Specificity
ACADVL - acyl-Coenzyme A dehydrogenase, very long chain
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACADVL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Positive Control
ACADVL Lysate (NBP2-65799)
Reviewed Applications
Read 1 Review rated 4
using
H00000037-M01 in the following applications:

Publications
Read Publications using H00000037-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACADVL Antibody (5D3)

  • ACAD6
  • acyl-CoA dehydrogenase, very long chain
  • acyl-Coenzyme A dehydrogenase, very long chain
  • EC 1.3.99
  • EC 1.3.99.-
  • LCACD
  • very long-chain specific acyl-CoA dehydrogenase, mitochondrial
  • VLCAD

Background

The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89289
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-83387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3998
Species: Hu
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-18783
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000037-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P

Publications for ACADVL Antibody (H00000037-M01)(2)

Review for ACADVL Antibody (H00000037-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00000037-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ACADVL H00000037-M01
Enlarge
reviewed by:
Anonymous
WB Mouse 03/26/2018
View

Summary

ApplicationWestern Blot
Sample TestedLiver
SpeciesMouse
Lot6335-5d3-00acy6

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACADVL Antibody (H00000037-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional ACADVL Products

Bioinformatics Tool for ACADVL Antibody (H00000037-M01)

Discover related pathways, diseases and genes to ACADVL Antibody (H00000037-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACADVL Antibody (H00000037-M01)

Discover more about diseases related to ACADVL Antibody (H00000037-M01).
 

Pathways for ACADVL Antibody (H00000037-M01)

View related products by pathway.

PTMs for ACADVL Antibody (H00000037-M01)

Learn more about PTMs related to ACADVL Antibody (H00000037-M01).

Blogs on ACADVL

There are no specific blogs for ACADVL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
03/26/2018
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol ACADVL
Entrez
OMIM
Uniprot