ACADSB Antibody - BSA Free

Western Blot: ACADSB Antibody [NBP3-17009] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil

Immunohistochemistry-Paraffin: ACADSB Antibody [NBP3-17009] - Staining of human placenta shows low expression as expected.

Immunohistochemistry-Paraffin: ACADSB Antibody [NBP3-17009] - Analysis in human liver and placenta tissues using Anti-ACADSB antibody. Corresponding ACADSB RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ACADSB Antibody [NBP3-17009] - Staining of human liver shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACADSB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACADSB Antibody - BSA Free (NBP3-17009) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACADSB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ACADSB Antibody - BSA Free

• 2-MEBCAD
• 2-methylbutyryl-coenzyme A dehydrogenase
• ACAD7,2-methylbutyryl-CoA dehydrogenase
• ACADSB
• acyl-CoA dehydrogenase, short/branched chain
• acyl-Coenzyme A dehydrogenase, short/branched chain
• EC 1.3.8.5
• EC 1.3.99,2-methyl branched chain acyl-CoA dehydrogenase
• EC 1.3.99.-
• SBCAD
• SBCADshort/branched chain specific acyl-CoA dehydrogenase, mitochondrial

Background

Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes thatcatalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids.Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB geneproduct has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, butalso reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. ThecDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield amature peptide of approximately 43.7-KDa. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACADSB