ACADSB Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACADSB Antibody [NBP2-48739] - Staining in human liver and placenta tissues using anti-ACADSB antibody. Corresponding ACADSB RNA-seq data are presented for ...read more
Orthogonal Strategies: Western Blot: ACADSB Antibody [NBP2-48739] - Analysis in human cell lines A-431 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Immunocytochemistry/ Immunofluorescence: ACADSB Antibody [NBP2-48739] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Western Blot: ACADSB Antibody [NBP2-48739] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunohistochemistry-Paraffin: ACADSB Antibody [NBP2-48739] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: ACADSB Antibody [NBP2-48739] - Staining of human placenta shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ACADSB Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHIDAE
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACADSB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACADSB Recombinant Protein Antigen (NBP2-48739PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACADSB Antibody

  • 2-MEBCAD
  • 2-methylbutyryl-coenzyme A dehydrogenase
  • ACAD7,2-methylbutyryl-CoA dehydrogenase
  • ACADSB
  • acyl-CoA dehydrogenase, short/branched chain
  • acyl-Coenzyme A dehydrogenase, short/branched chain
  • EC 1.3.8.5
  • EC 1.3.99,2-methyl branched chain acyl-CoA dehydrogenase
  • EC 1.3.99.-
  • SBCAD
  • SBCADshort/branched chain specific acyl-CoA dehydrogenase, mitochondrial

Background

Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes thatcatalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids.Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB geneproduct has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, butalso reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. ThecDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield amature peptide of approximately 43.7-KDa. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-89290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03047
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02118
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DY2037
Species: Hu
Applications: ELISA
NBP2-46477
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, WB
NBP1-85786
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87302
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59357
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32883
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP3-12940
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-85495
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
4776-SE
Species: Hu
Applications: EnzAct
NBP1-83978
Species: Hu
Applications: IHC, IHC-P
NBP1-82609
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
NBP1-90813
Species: Hu
Applications: IHC, IHC-P, WB

Publications for ACADSB Antibody (NBP2-48739) (0)

There are no publications for ACADSB Antibody (NBP2-48739).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACADSB Antibody (NBP2-48739) (0)

There are no reviews for ACADSB Antibody (NBP2-48739). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACADSB Antibody (NBP2-48739) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACADSB Products

Bioinformatics Tool for ACADSB Antibody (NBP2-48739)

Discover related pathways, diseases and genes to ACADSB Antibody (NBP2-48739). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACADSB Antibody (NBP2-48739)

Discover more about diseases related to ACADSB Antibody (NBP2-48739).
 

Pathways for ACADSB Antibody (NBP2-48739)

View related products by pathway.

PTMs for ACADSB Antibody (NBP2-48739)

Learn more about PTMs related to ACADSB Antibody (NBP2-48739).
 

Research Areas for ACADSB Antibody (NBP2-48739)

Find related products by research area.

Blogs on ACADSB

There are no specific blogs for ACADSB, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACADSB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACADSB