ACADSB Antibody

Immunohistochemistry-Paraffin: ACADSB Antibody [NBP2-48739] - Staining in human liver and placenta tissues using anti-ACADSB antibody. Corresponding ACADSB RNA-seq data are presented for the same tissues.

Western Blot: ACADSB Antibody [NBP2-48739] - Analysis in human cell lines A-431 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: ACADSB Antibody [NBP2-48739] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.

Western Blot: ACADSB Antibody [NBP2-48739] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: ACADSB Antibody [NBP2-48739] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: ACADSB Antibody [NBP2-48739] - Staining of human placenta shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ACADSB Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHIDAE
• Predicted Species: Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACADSB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ACADSB Recombinant Protein Antigen (NBP2-48739PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACADSB Antibody

• 2-MEBCAD
• 2-methylbutyryl-coenzyme A dehydrogenase
• ACAD7,2-methylbutyryl-CoA dehydrogenase
• ACADSB
• acyl-CoA dehydrogenase, short/branched chain
• acyl-Coenzyme A dehydrogenase, short/branched chain
• EC 1.3.8.5
• EC 1.3.99,2-methyl branched chain acyl-CoA dehydrogenase
• EC 1.3.99.-
• SBCAD
• SBCADshort/branched chain specific acyl-CoA dehydrogenase, mitochondrial

Background

Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes thatcatalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids.Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB geneproduct has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, butalso reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. ThecDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield amature peptide of approximately 43.7-KDa. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACADSB