ACADSB Antibody

Images

 
Western Blot: ACADSB Antibody [NBP1-54788] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACADSB Antibody Summary

Immunogen
Synthetic peptides corresponding to ACADSB(acyl-Coenzyme A dehydrogenase, short/branched chain) The peptide sequence was selected from the middle region of ACADSB (NP_001600). Peptide sequence GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACADSB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACADSB and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACADSB Antibody

  • 2-MEBCAD
  • 2-methylbutyryl-coenzyme A dehydrogenase
  • ACAD7,2-methylbutyryl-CoA dehydrogenase
  • acyl-CoA dehydrogenase, short/branched chain
  • acyl-Coenzyme A dehydrogenase, short/branched chain
  • EC 1.3.99,2-methyl branched chain acyl-CoA dehydrogenase
  • EC 1.3.99.-
  • SBCADshort/branched chain specific acyl-CoA dehydrogenase, mitochondrial

Background

Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB gene product has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. The cDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield a mature peptide of approximately 43.7-kDa. Sequence Note: The 3' UTR extension represented by the RefSeq transcript record was derived from genomic sequence data to optimize consistency to the reference genome assembly. The extent of the UTR extension and the location of the polyA site was based on transcript alignments.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30578
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84974
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76503
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-50204
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP1-80740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
H00003249-P01
Species: Hu
Applications: WB
NBP1-83978
Species: Hu
Applications: IHC, IHC-P
NBP2-38353
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ACADSB Antibody (NBP1-54788) (0)

There are no publications for ACADSB Antibody (NBP1-54788).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACADSB Antibody (NBP1-54788) (0)

There are no reviews for ACADSB Antibody (NBP1-54788). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACADSB Antibody (NBP1-54788) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ACADSB Antibody (NBP1-54788)

Discover related pathways, diseases and genes to ACADSB Antibody (NBP1-54788). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACADSB Antibody (NBP1-54788)

Discover more about diseases related to ACADSB Antibody (NBP1-54788).
 

Pathways for ACADSB Antibody (NBP1-54788)

View related products by pathway.

PTMs for ACADSB Antibody (NBP1-54788)

Learn more about PTMs related to ACADSB Antibody (NBP1-54788).

Blogs on ACADSB

There are no specific blogs for ACADSB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACADSB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACADSB
Entrez
Uniprot