ABRO Antibody

Images

 
Western Blot: ABRO Antibody [NBP1-90282] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ABRO Antibody [NBP1-90282] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABRO Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM175B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABRO Protein (NBP1-90282PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABRO Antibody

  • Abraxas brother protein 1
  • ABRO1abraxas brother 1
  • Em:AC068896.4
  • family with sequence similarity 175, member B
  • FLJ22338
  • KIAA0157BRISC complex subunit Abro1
  • Protein FAM175B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76831
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6604
Species: Hu
Applications: WB, IHC
NBP1-33038
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-87156
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56444
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-38356
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80956
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55522
Species: Hu
Applications: WB, ICC/IF
AF1988
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-90282
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ABRO Antibody (NBP1-90282) (0)

There are no publications for ABRO Antibody (NBP1-90282).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABRO Antibody (NBP1-90282) (0)

There are no reviews for ABRO Antibody (NBP1-90282). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABRO Antibody (NBP1-90282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABRO Products

Bioinformatics Tool for ABRO Antibody (NBP1-90282)

Discover related pathways, diseases and genes to ABRO Antibody (NBP1-90282). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ABRO

There are no specific blogs for ABRO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABRO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM175B