ABRO Antibody

Western Blot: ABRO Antibody [NBP1-90282] - Analysis in human cell line NB4.

Immunohistochemistry-Paraffin: ABRO Antibody [NBP1-90282] - Staining of human colon strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ABRO Antibody [NBP1-90282] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.

Immunohistochemistry-Paraffin: ABRO Antibody [NBP1-90282] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ABRO Antibody [NBP1-90282] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ABRO Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABRAXAS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ABRO Protein (NBP1-90282PEP)

Reactivity Notes

Mouse, Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ABRO Antibody

• Abraxas brother protein 1
• ABRO1abraxas brother 1
• Em:AC068896.4
• family with sequence similarity 175, member B
• FLJ22338
• KIAA0157BRISC complex subunit Abro1
• Protein FAM175B

Background

ABRO, also known as KIAA0157, is a hypothetical protein predicted from the in silico analysis of long cDNAs isolated in the Kazusa cDNA sequencing project. The function of ABRO has not been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABRAXAS2