Recombinant Human ABR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ABR Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-110 of Human ABR partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV

Protein/Peptide Type
Partial Recombinant Protein
Gene
ABR

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABR Protein

  • active BCR-related gene
  • active breakpoint cluster region-related protein
  • FLJ45954
  • MDB

Background

ABR - active BCR-related gene

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5535
Species: Hu
Applications: WB, Simple Western
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBL1-14964
Species: Hu
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00000029-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ABR Partial Recombinant Protein (H00000029-Q01) (0)

There are no publications for ABR Partial Recombinant Protein (H00000029-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABR Partial Recombinant Protein (H00000029-Q01) (0)

There are no reviews for ABR Partial Recombinant Protein (H00000029-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABR Partial Recombinant Protein (H00000029-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABR Products

Bioinformatics Tool for ABR Partial Recombinant Protein (H00000029-Q01)

Discover related pathways, diseases and genes to ABR Partial Recombinant Protein (H00000029-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABR Partial Recombinant Protein (H00000029-Q01)

Discover more about diseases related to ABR Partial Recombinant Protein (H00000029-Q01).
 

Pathways for ABR Partial Recombinant Protein (H00000029-Q01)

View related products by pathway.

PTMs for ABR Partial Recombinant Protein (H00000029-Q01)

Learn more about PTMs related to ABR Partial Recombinant Protein (H00000029-Q01).
 

Research Areas for ABR Partial Recombinant Protein (H00000029-Q01)

Find related products by research area.

Blogs on ABR

There are no specific blogs for ABR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABR Antibody
NBP1-30981

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABR