ABLIM1 Antibody - BSA Free

Western Blot: ABLIM1 Antibody [NBP1-89303] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: ABLIM1 Antibody [NBP1-89303] - Staining of human esophagus shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABLIM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ABLIM1 Antibody - BSA Free (NBP1-89303) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFFYSKSLIRRTGRSPSLQPTRTSS
• Predicted Species: Mouse (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABLIM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ABLIM1 Recombinant Protein Antigen (NBP1-89303PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ABLIM1 Antibody - BSA Free

• ABLIM
• abLIM-1
• actin binding LIM protein 1
• Actin-binding double zinc finger protein
• actin-binding double-zinc-finger protein
• actin-binding LIM protein 1
• Actin-binding LIM protein family member 1
• DKFZp781D0148
• FLJ14564
• KIAA0059
• LIM actin-binding protein 1
• LIMAB1MGC1224
• LIMATIN

Background

ABLIM1 (actin-binding LIM protein 1) was isolated as a cDNA that encoded dematin-like polypeptides in the human retina. Dematin and dematin-like proteins are actin-associated proteins that play roles in cytoskeletal regulation and morphogenesis. ABLIM1 is a LIM (Lin-11 Isl-1 mec03) motif containing protein characterized by the presences of cysteine-rich double zinc-fingers that play a role in diverse developmental programs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABLIM1
• Entrez:
  • 3983(Human)
• Uniprot:
  • O14639(Human)