ABLIM3 Antibody - BSA Free

Western Blot: ABLIM3 Antibody [NBP1-81471] - Analysis in human cell line PC-3.

Immunocytochemistry/Immunofluorescence: ABLIM3 Antibody [NBP1-81471] - Staining of human cell line PC-3 shows localization to nucleoplasm & plasma membrane.

Immunohistochemistry-Paraffin: ABLIM3 Antibody [NBP1-81471] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABLIM3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRT
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABLIM3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ABLIM3 Protein (NBP1-81471PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ABLIM3 Antibody - BSA Free

• actin binding LIM protein family, member 3
• actin-binding LIM protein 3

Background

The LIM domain is a double zinc finger structure that promotes protein-protein interactions. LIM domain proteins, such as ABLIM3, play roles in embryonic development, cell lineage determination, and cancer (Krupp et al., 2006 [PubMed 16328021]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ABLIM3 Antibody (NBP1-81471)(3)

Publications using NBP1-81471

• Lee J, Jeong S, Lee CR et al. GLI1 Transcription Factor Affects Tumor Aggressiveness in Patients With Papillary Thyroid Cancers. Medicine (Baltimore) 2015-06-01 [PMID: 26107686] (IF/IHC, Human)
• Cao J, Shen Y, Zhu L et al. miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics. Nat Cell Biol 2012-06-01 [PMID: 22684256]
• Li A, Ponten F, dos Remedios CG. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics 2012-01-01 [PMID: 22253135]

Bioinformatics

• Gene Symbol: ABLIM3
• Entrez:
  • 22885(Human)
• Uniprot:
  • O94929(Human)