ABL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ABL2 Antibody [NBP1-89302] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ABL2 Antibody [NBP1-89302] - Staining of human gallbladder shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABL2 Protein (NBP1-89302PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABL2 Antibody

  • Abelson murine leukemia viral (v-abl) oncogene homolog 2
  • Abelson murine leukemia viral oncogene homolog 2
  • Abelson-related gene protein
  • Abelson-relatedgene)
  • arg tyrosine kinase
  • EC 2.7.10
  • EC 2.7.10.2
  • FLJ22224
  • FLJ31718
  • FLJ41441
  • tyrosine-protein kinase ABL2
  • Tyrosine-protein kinase ARG
  • v-abl Abelson murine leukemia viral oncogene homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF5414
Species: Hu
Applications: WB, Simple Western
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-49154
Species: Hu
Applications: IHC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89302
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ABL2 Antibody (NBP1-89302) (0)

There are no publications for ABL2 Antibody (NBP1-89302).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABL2 Antibody (NBP1-89302) (0)

There are no reviews for ABL2 Antibody (NBP1-89302). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABL2 Antibody (NBP1-89302) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABL2 Products

Bioinformatics Tool for ABL2 Antibody (NBP1-89302)

Discover related pathways, diseases and genes to ABL2 Antibody (NBP1-89302). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABL2 Antibody (NBP1-89302)

Discover more about diseases related to ABL2 Antibody (NBP1-89302).
 

Pathways for ABL2 Antibody (NBP1-89302)

View related products by pathway.

PTMs for ABL2 Antibody (NBP1-89302)

Learn more about PTMs related to ABL2 Antibody (NBP1-89302).

Blogs on ABL2

There are no specific blogs for ABL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABL2