ABHD2 Antibody

Images

 
Western Blot: ABHD2 Antibody [NBP1-82850] - Analysis in control (vector only transfected HEK293T lysate) and ABHD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: ABHD2 Antibody [NBP1-82850] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ABHD2 Antibody [NBP1-82850] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABHD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABHD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ABHD2 Protein (NBP1-82850PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABHD2 Antibody

  • abhydrolase domain containing 2
  • abhydrolase domain-containing protein 2
  • alpha/beta hydrolase domain containing protein 2
  • EC 3.1.1
  • EC 3.1.1.-
  • HS1-2
  • LABH2PHPS1-2
  • Lung alpha/beta hydrolase 2
  • MGC111112
  • MGC26249
  • Protein PHPS1-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81327
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91644
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74392
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1195
Species: Hu
Applications: WB, IHC, Neut
NBP1-88212
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-36727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
AF2864
Species: Hu
Applications: WB, ICC
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBL1-13921
Species: Hu
NBP1-90976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52047
Species: Hu, Mu
Applications: WB, IHC, PEP-ELISA
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-82850
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ABHD2 Antibody (NBP1-82850) (0)

There are no publications for ABHD2 Antibody (NBP1-82850).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABHD2 Antibody (NBP1-82850) (0)

There are no reviews for ABHD2 Antibody (NBP1-82850). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABHD2 Antibody (NBP1-82850) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABHD2 Products

Bioinformatics Tool for ABHD2 Antibody (NBP1-82850)

Discover related pathways, diseases and genes to ABHD2 Antibody (NBP1-82850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABHD2 Antibody (NBP1-82850)

Discover more about diseases related to ABHD2 Antibody (NBP1-82850).
 

Pathways for ABHD2 Antibody (NBP1-82850)

View related products by pathway.

Blogs on ABHD2

There are no specific blogs for ABHD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABHD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABHD2
Entrez
Uniprot