ABH1 Antibody


Western Blot: ABH1 Antibody [NBP2-14283] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: ABH1 Antibody [NBP2-14283] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ABH1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDIS TEGFCHLDDQNSEVKRARIN
Specificity of human ABH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ABH1 Protein (NBP2-14283PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ABH1 Antibody

  • ABH1
  • ABHalkB, alkylation repair homolog (E. coli)
  • alkB
  • alkB, alkylation repair homolog 1 (E. coli)
  • alkylated DNA repair protein alkB homolog 1
  • alkylation repair, alkB homolog
  • Alpha-ketoglutarate-dependent dioxygenase ABH1
  • DNA lyase ABH1
  • EC 1.14.11.-
  • EC
  • hABH


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, PLA
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for ABH1 Antibody (NBP2-14283) (0)

There are no publications for ABH1 Antibody (NBP2-14283).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABH1 Antibody (NBP2-14283) (0)

There are no reviews for ABH1 Antibody (NBP2-14283). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABH1 Antibody (NBP2-14283) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ABH1 Products

Bioinformatics Tool for ABH1 Antibody (NBP2-14283)

Discover related pathways, diseases and genes to ABH1 Antibody (NBP2-14283). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABH1 Antibody (NBP2-14283)

Discover more about diseases related to ABH1 Antibody (NBP2-14283).

Pathways for ABH1 Antibody (NBP2-14283)

View related products by pathway.

PTMs for ABH1 Antibody (NBP2-14283)

Learn more about PTMs related to ABH1 Antibody (NBP2-14283).

Research Areas for ABH1 Antibody (NBP2-14283)

Find related products by research area.

Blogs on ABH1

There are no specific blogs for ABH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABH1 Antibody and receive a gift card or discount.


Gene Symbol ALKBH1