ABH1 Antibody (5K4W5)

Western Blot: ABH1 Antibody (5K4W5) [NBP3-16787] -Analysis of various lysates, using ALKBH1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry: ABH1 Antibody (5K4W5) [NBP3-16787] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using ABH1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ABH1 Antibody (5K4W5) [NBP3-16787] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using ABH1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ABH1 Antibody (5K4W5) [NBP3-16787] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using ABH1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ABH1 Antibody (5K4W5) [ABH1] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using ABH1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ABH1 Antibody (5K4W5) [ABH1] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using ABH1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ABH1 Antibody (5K4W5) [ABH1] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using ABH1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 5K4W5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ABH1 Antibody (5K4W5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ABH1 (Q13686). MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFI
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ALKBH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ABH1 Antibody (5K4W5)

• ABH1
• ABHalkB, alkylation repair homolog (E. coli)
• alkB
• alkB, alkylation repair homolog 1 (E. coli)
• ALKBH
• alkylated DNA repair protein alkB homolog 1
• alkylation repair, alkB homolog
• Alpha-ketoglutarate-dependent dioxygenase ABH1
• DNA lyase ABH1
• EC 1.14.11.-
• EC 4.2.99.18
• hABH

Background

ABH1 encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALKBH1