Recombinant Human ABCG2/CD338 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ABCG2/CD338 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 156-265 of Human ABCG2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSIFKLFDSLTLLASGRLM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ABCG2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABCG2/CD338 Protein

  • ABC transporter
  • ABC15
  • ABCG2
  • ABCP
  • ABCPMGC102821
  • ATP-binding cassette sub-family G member 2
  • ATP-binding cassette transporter G2
  • ATP-binding cassette, sub-family G (WHITE), member 2
  • BCRP
  • BCRP1
  • BCRPMRX
  • BMDP
  • Breast cancer resistance protein
  • CD338 antigen
  • CD338
  • CDw338
  • EST157481
  • mitoxantrone resistance protein
  • Mitoxantrone resistance-associated protein
  • MXR
  • MXRMXR1
  • placenta specific MDR protein
  • Placenta-specific ATP-binding cassette transporter

Background

The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46466
Species: Hu
Applications: IHC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF6278
Species: Hu, Mu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB4077
Species: Hu
Applications: WB, IHC
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00009429-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02) (0)

There are no publications for ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02) (0)

There are no reviews for ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCG2/CD338 Products

Bioinformatics Tool for ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02)

Discover related pathways, diseases and genes to ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02)

Discover more about diseases related to ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02).
 

Pathways for ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02)

View related products by pathway.

PTMs for ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02)

Learn more about PTMs related to ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02).
 

Research Areas for ABCG2/CD338 Partial Recombinant Protein (H00009429-Q02)

Find related products by research area.

Blogs on ABCG2/CD338

There are no specific blogs for ABCG2/CD338, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MDMX Antibody
NB100-556
MRP1 Antibody (IU2H10)
NB400-156-0.1ml

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABCG2/CD338 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCG2
Entrez