ABCD4 Antibody

Images

 
Immunohistochemistry-Paraffin: ABCD4 Antibody [NBP1-83954] - Staining of human fallopian tube shows membrane positivity in glandular cells.
Immunohistochemistry: ABCD4 Antibody [NBP1-83954] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCD4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTHRIGQLRETLLDMSLKSQDCEILGESEWGLDTPPGWPAAEPADTAFLLERVSISAPSSDKPLIKDLSLKISEGQSLLITGNTGTGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABCD4 Protein (NBP1-83954PEP)
Publications
Read Publication using NBP1-83954.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%). Reactivity reported in scientific literature (PMID: 22922874)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCD4 Antibody

  • ATP-binding cassette sub-family D member 4
  • ATP-binding cassette, sub-family D (ALD), member 4
  • EST352188
  • P70R69 kDa peroxisomal ABC-transporter
  • Peroxisomal membrane protein 1-like
  • Peroxisomal membrane protein 69
  • PMP69P79R
  • PMP70-related protein
  • PXMP1-L
  • PXMP1LABC41

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46476
Species: Hu
Applications: WB, IHC
NBP2-36770
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33435
Species: Hu
Applications: WB
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB400-166
Species: Mu
Applications: WB, Flow, IHC-P
NB400-116
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB400-115
Species: Hu, Mu, Ye
Applications: WB, Simple Western, ICC/IF
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
H00338917-T01
Species: Hu
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP

Publications for ABCD4 Antibody (NBP1-83954)(1)

Reviews for ABCD4 Antibody (NBP1-83954) (0)

There are no reviews for ABCD4 Antibody (NBP1-83954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ABCD4 Antibody (NBP1-83954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCD4 Products

Bioinformatics Tool for ABCD4 Antibody (NBP1-83954)

Discover related pathways, diseases and genes to ABCD4 Antibody (NBP1-83954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCD4 Antibody (NBP1-83954)

Discover more about diseases related to ABCD4 Antibody (NBP1-83954).
 

Pathways for ABCD4 Antibody (NBP1-83954)

View related products by pathway.

PTMs for ABCD4 Antibody (NBP1-83954)

Learn more about PTMs related to ABCD4 Antibody (NBP1-83954).

Blogs on ABCD4

There are no specific blogs for ABCD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCD4
Entrez
Uniprot