Recombinant Human ABCC5 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ABCC5 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-208 of Human ABCC5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPNFQDGCILRSE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ABCC5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
50.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABCC5 GST (N-Term) Protein

  • ATP-binding cassette sub-family C member 5
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 5
  • canalicular multispecific organic anion transporter C
  • EST277145
  • MOAT-CABC33
  • MRP5MOATC
  • multidrug resistance-associated protein 5
  • Multi-specific organic anion transporter C
  • pABC11
  • SMRPDKFZp686C1782

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that this protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. This protein may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing of this gene has been detected; however, the complete sequence and translation initiation site is unclear. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NBP2-66958
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-556
Species: Hu
Applications: IP, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-42342
Species: Hu
Applications: Flow, IHC, IHC-Fr, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-20944
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-79724
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PA
MAB25031
Species: Hu
Applications: IHC, IP, WB
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF3059
Species: Mu
Applications: ICC, Simple Western, WB

Publications for ABCC5 Recombinant Protein (H00010057-P01) (0)

There are no publications for ABCC5 Recombinant Protein (H00010057-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCC5 Recombinant Protein (H00010057-P01) (0)

There are no reviews for ABCC5 Recombinant Protein (H00010057-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCC5 Recombinant Protein (H00010057-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCC5 Products

Bioinformatics Tool for ABCC5 Recombinant Protein (H00010057-P01)

Discover related pathways, diseases and genes to ABCC5 Recombinant Protein (H00010057-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCC5 Recombinant Protein (H00010057-P01)

Discover more about diseases related to ABCC5 Recombinant Protein (H00010057-P01).
 

Pathways for ABCC5 Recombinant Protein (H00010057-P01)

View related products by pathway.

PTMs for ABCC5 Recombinant Protein (H00010057-P01)

Learn more about PTMs related to ABCC5 Recombinant Protein (H00010057-P01).
 

Research Areas for ABCC5 Recombinant Protein (H00010057-P01)

Find related products by research area.

Blogs on ABCC5

There are no specific blogs for ABCC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABCC5 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC5