Recombinant Human ABCC11 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ABCC11 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 553 of Human ABCC11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTRKRTYWVPNSSGGLVNRGIDIGDDMVSGLIYKTYTLQDGPWSQQERNPEAPGRAAVPPWGKYDAALRTMIPFRPKPRFPAPQPLDNAGLFSYLTVSWLTPLMIQSLRSRLDENTIPPLSVHDASDKNVQRLHRLWEEEVSRRGIEKASVLLVMLRFQRTRLIFDALLGICFCIASVLGPILIIPKILEYSEEQLGNVVHGVGLCFALFLSECVKSLSFSSSWIINQRTAIRFRAAVSSFAFEKLIQFKSVIHITSGEAISFFTGDVNYLFEGVCYGPLVLITCASLVICSISSYFIIGYTAFIAILCYLLVFPLAVFMTRMAVKAQHHTSEVSDQRIRVTSEVLTCIKLIKMYTWEKPFAKIIEDLRRKERKLLEKCGLVQSLTSITLFIIPTVATAVWVLIHTSLKLKLTASMAFSMLASLNLLRLSVFFVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSKVALFRPRRQASCQALRT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ABCC11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
88.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABCC11 Protein

  • ATP-binding cassette protein C11
  • ATP-binding cassette transporter MRP8
  • ATP-binding cassette transporter sub-family C member 11
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 11
  • EWWD
  • MRP8ATP-binding cassette sub-family C member 11
  • Multidrug resistance-associated protein 8
  • multi-resistance protein 8
  • WW

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46467
Species: Hu
Applications: WB, IHC
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81034
Species: Hu
Applications: IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00085320-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ABCC11 Recombinant Protein (H00085320-P01) (0)

There are no publications for ABCC11 Recombinant Protein (H00085320-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCC11 Recombinant Protein (H00085320-P01) (0)

There are no reviews for ABCC11 Recombinant Protein (H00085320-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCC11 Recombinant Protein (H00085320-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCC11 Products

Bioinformatics Tool for ABCC11 Recombinant Protein (H00085320-P01)

Discover related pathways, diseases and genes to ABCC11 Recombinant Protein (H00085320-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCC11 Recombinant Protein (H00085320-P01)

Discover more about diseases related to ABCC11 Recombinant Protein (H00085320-P01).
 

Pathways for ABCC11 Recombinant Protein (H00085320-P01)

View related products by pathway.

PTMs for ABCC11 Recombinant Protein (H00085320-P01)

Learn more about PTMs related to ABCC11 Recombinant Protein (H00085320-P01).

Blogs on ABCC11

There are no specific blogs for ABCC11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCC11 Antibody
NBP1-82623

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABCC11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC11