ABCC11 Recombinant Protein Antigen

Images

 
There are currently no images for ABCC11 Recombinant Protein Antigen (NBP1-82623PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ABCC11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCC11.

Source: E. coli

Amino Acid Sequence: ESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCC11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82623.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCC11 Recombinant Protein Antigen

  • ATP-binding cassette protein C11
  • ATP-binding cassette transporter MRP8
  • ATP-binding cassette transporter sub-family C member 11
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 11
  • EWWD
  • MRP8ATP-binding cassette sub-family C member 11
  • Multidrug resistance-associated protein 8
  • multi-resistance protein 8
  • WW

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
AF3059
Species: Mu
Applications: ICC, Simple Western, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-46186
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP2-46467
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-20945
Species: Bv, Ca, Hu, Mu, Rt
Applications: PEP-ELISA
NBP1-69023
Species: Mu
Applications: WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
DY1707
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for ABCC11 Recombinant Protein Antigen (NBP1-82623PEP) (0)

There are no publications for ABCC11 Recombinant Protein Antigen (NBP1-82623PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCC11 Recombinant Protein Antigen (NBP1-82623PEP) (0)

There are no reviews for ABCC11 Recombinant Protein Antigen (NBP1-82623PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCC11 Recombinant Protein Antigen (NBP1-82623PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCC11 Products

Blogs on ABCC11

There are no specific blogs for ABCC11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCC11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC11