ABCC11 Antibody

Western Blot: ABCC11 Antibody [H00085320-B01P] - Analysis of ABCC11 expression in HepG2.

Western Blot: ABCC11 Antibody [H00085320-B01P] - Analysis of ABCC11 expression in transfected 293T cell line by ABCC11 polyclonal antibody. Lane 1: ABCC11 transfected lysate(60.83 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

ABCC11 Antibody Summary

• Immunogen: ABCC11 (AAH39085, 1 a.a. - 553 a.a.) full-length human protein. MTRKRTYWVPNSSGGLVNRGIDIGDDMVSGLIYKTYTLQDGPWSQQERNPEAPGRAAVPPWGKYDAALRTMIPFRPKPRFPAPQPLDNAGLFSYLTVSWLTPLMIQSLRSRLDENTIPPLSVHDASDKNVQRLHRLWEEEVSRRGIEKASVLLVMLRFQRTRLIFDALLGICFCIASVLGPILIIPKILEYSEEQLGNVVHGVGLCFALFLSECVKSLSFSSSWIINQRTAIRFRAAVSSFAFEKLIQFKSVIHITSGEAISFFTGDVNYLFEGVCYGPLVLITCASLVICSISSYFIIGYTAFIAILCYLLVFPLAVFMTRMAVKAQHHTSEVSDQRIRVTSEVLTCIKLIKMYTWEKPFAKIIEDLRRKERKLLEKCGLVQSLTSITLFIIPTVATAVWVLIHTSLKLKLTASMAFSMLASLNLLRLSVFFVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSKVALFRPRRQASCQALRT
• Specificity: ABCC11 - ATP-binding cassette, sub-family C (CFTR/MRP), member 11,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ABCC11
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ABCC11 Antibody

• ATP-binding cassette protein C11
• ATP-binding cassette transporter MRP8
• ATP-binding cassette transporter sub-family C member 11
• ATP-binding cassette, sub-family C (CFTR/MRP), member 11
• EWWD
• MRP8ATP-binding cassette sub-family C member 11
• Multidrug resistance-associated protein 8
• multi-resistance protein 8
• WW

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCC11
• Entrez:
  • 85320(Human)