ABCB9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ABCB9 Antibody [NBP2-55166] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCB9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSHKA
Specificity
Specificity of human ABCB9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCB9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABCB9 Recombinant Protein Antigen (NBP2-55166PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ABCB9 Antibody

  • ABC transporter 9 protein
  • ATP-binding cassette sub-family B member 9
  • ATP-binding cassette transporter 9
  • ATP-binding cassette, sub-family B (MDR/TAP), member 9
  • EC 3.6.3
  • EC 3.6.3.44
  • EST122234
  • hABCB9
  • KIAA1520
  • TAPL
  • TAP-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006890-M04
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-93797
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008615-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP2-22217
Species: Hu, Mu, Ch, Rt(-)
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP2-92883
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP2-30876
Species: Hu
Applications: IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Ca, Fe, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF873
Species: Hu
Applications: WB
NB100-556
Species: Hu
Applications: WB, IP
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ABCB9 Antibody (NBP2-55166) (0)

There are no publications for ABCB9 Antibody (NBP2-55166).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCB9 Antibody (NBP2-55166) (0)

There are no reviews for ABCB9 Antibody (NBP2-55166). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABCB9 Antibody (NBP2-55166) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ABCB9 Products

Bioinformatics Tool for ABCB9 Antibody (NBP2-55166)

Discover related pathways, diseases and genes to ABCB9 Antibody (NBP2-55166). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCB9 Antibody (NBP2-55166)

Discover more about diseases related to ABCB9 Antibody (NBP2-55166).
 

Pathways for ABCB9 Antibody (NBP2-55166)

View related products by pathway.

PTMs for ABCB9 Antibody (NBP2-55166)

Learn more about PTMs related to ABCB9 Antibody (NBP2-55166).
 

Research Areas for ABCB9 Antibody (NBP2-55166)

Find related products by research area.

Blogs on ABCB9

There are no specific blogs for ABCB9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCB9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCB9