ABCB8 Antibody

Images

 
Western Blot: ABCB8 Antibody [NBP2-86935] - WB Suggested Anti-Abcb8 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Muscle

Product Details

Summary
Reactivity Mu, Hu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCB8 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse ABCB8. Peptide sequence: ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ABCB8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCB8 Antibody

  • ATP-binding cassette, sub-family B (MDR/TAP), member 8
  • EC 3.6.3
  • EST328128
  • M-ABC1mitochondrial ABC protein
  • Mitochondrial ATP-binding cassette 1
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-92864
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92618
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-77687
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-18886
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
H00006890-M04
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-01346
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-93797
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
MAB2384
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22403
Species: Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
H00008615-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P

Publications for ABCB8 Antibody (NBP2-86935) (0)

There are no publications for ABCB8 Antibody (NBP2-86935).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCB8 Antibody (NBP2-86935) (0)

There are no reviews for ABCB8 Antibody (NBP2-86935). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCB8 Antibody (NBP2-86935) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ABCB8 Products

Bioinformatics Tool for ABCB8 Antibody (NBP2-86935)

Discover related pathways, diseases and genes to ABCB8 Antibody (NBP2-86935). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCB8 Antibody (NBP2-86935)

Discover more about diseases related to ABCB8 Antibody (NBP2-86935).
 

Pathways for ABCB8 Antibody (NBP2-86935)

View related products by pathway.

Blogs on ABCB8

There are no specific blogs for ABCB8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCB8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCB8