ABCB7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ABCB7 Antibody [NBP1-89313] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ABCB7 Antibody [NBP1-89313] - Staining of human lung shows strong membranous positivity in alveolar cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCB7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCB7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABCB7 Protein (NBP1-89313PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCB7 Antibody

  • ABC transporter 7 protein
  • ABC7ATP-binding cassette sub-family B member 7, mitochondrial
  • ASATATP-binding cassette 7
  • Atm1p
  • ATP-binding cassette transporter 7
  • ATP-binding cassette, sub-family B (MDR/TAP), member 7
  • EC 3.6.3
  • EC 3.6.3.42
  • EST140535

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-54724
Species: Hu
Applications: WB, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35006
Species: Hu
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-89313
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ABCB7 Antibody (NBP1-89313) (0)

There are no publications for ABCB7 Antibody (NBP1-89313).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCB7 Antibody (NBP1-89313) (0)

There are no reviews for ABCB7 Antibody (NBP1-89313). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABCB7 Antibody (NBP1-89313) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCB7 Products

Bioinformatics Tool for ABCB7 Antibody (NBP1-89313)

Discover related pathways, diseases and genes to ABCB7 Antibody (NBP1-89313). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCB7 Antibody (NBP1-89313)

Discover more about diseases related to ABCB7 Antibody (NBP1-89313).
 

Pathways for ABCB7 Antibody (NBP1-89313)

View related products by pathway.

PTMs for ABCB7 Antibody (NBP1-89313)

Learn more about PTMs related to ABCB7 Antibody (NBP1-89313).
 

Research Areas for ABCB7 Antibody (NBP1-89313)

Find related products by research area.

Blogs on ABCB7

There are no specific blogs for ABCB7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCB7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCB7
Entrez
Uniprot