ABCA9 Antibody


Immunocytochemistry/ Immunofluorescence: ABCA9 Antibody [NBP2-68700] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

ABCA9 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
ABCA9 Recombinant Protein Antigen (NBP2-68700PEP)

Reactivity Notes

Mouse 84%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for ABCA9 Antibody

  • ATP-binding cassette A9
  • ATP-binding cassette sub-family A member 9
  • ATP-binding cassette, sub-family A (ABC1), member 9
  • DKFZp686F2450
  • EC 3.6.3
  • EC
  • EST640918
  • MGC75415


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-Fr, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB

Publications for ABCA9 Antibody (NBP2-68700) (0)

There are no publications for ABCA9 Antibody (NBP2-68700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA9 Antibody (NBP2-68700) (0)

There are no reviews for ABCA9 Antibody (NBP2-68700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABCA9 Antibody (NBP2-68700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ABCA9 Products

Array NBP2-68700

Bioinformatics Tool for ABCA9 Antibody (NBP2-68700)

Discover related pathways, diseases and genes to ABCA9 Antibody (NBP2-68700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA9 Antibody (NBP2-68700)

Discover more about diseases related to ABCA9 Antibody (NBP2-68700).

Pathways for ABCA9 Antibody (NBP2-68700)

View related products by pathway.

Research Areas for ABCA9 Antibody (NBP2-68700)

Find related products by research area.

Blogs on ABCA9

There are no specific blogs for ABCA9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABCA9 Antibody and receive a gift card or discount.


Gene Symbol ABCA9