We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ABCA12 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related ABCA12 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-69062PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ABCA12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCA12.

Source: E. coli

Amino Acid Sequence: LRRKGIDDALFKDSEILRKSSNLDKDSSLSFQSTQVPERRHASLATVFPSPSSDLEIPGTYTFNGSQVLARILGLEKLLKQNSTSEDI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCA12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-69062.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCA12 Recombinant Protein Antigen

  • ABC12
  • ATP-binding cassette 12
  • ATP-binding cassette transporter 12
  • ATP-binding cassette, sub-family A (ABC1), member 12
  • DKFZP434G232
  • EC 3.6.3
  • EC 3.6.3.25
  • FLJ41584
  • ichthyosis congenita II, lamellar ichthyosis B
  • ICR2B
  • LI2ATP-binding cassette sub-family A member 12

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily, which is the only major ABC subfamily found exclusively in multicellular eukaryotes. Alternative splicing of this gene results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-89165
Species: Hu
Applications: IHC,  IHC-P
NBP2-34062
Species: Hu
Applications:  IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NB400-115
Species: Hu, Mu, Ye
Applications: ICC/IF, KD, Simple Western, WB
NB400-163
Species: Mu
Applications: Flow, IHC,  IHC-P, WB
H00126410-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-89409
Species: Hu
Applications: ICC/IF,  IHC-P
NBP1-87528
Species: Hu
Applications: ICC/IF,  IHC-P
NBP1-89314
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
1108-SE
Species: Hu
Applications: EnzAct
NBP1-80712
Species: Hu
Applications: ICC/IF
NBP2-69062PEP
Species: Hu
Applications: AC

Publications for ABCA12 Recombinant Protein Antigen (NBP2-69062PEP) (0)

There are no publications for ABCA12 Recombinant Protein Antigen (NBP2-69062PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA12 Recombinant Protein Antigen (NBP2-69062PEP) (0)

There are no reviews for ABCA12 Recombinant Protein Antigen (NBP2-69062PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCA12 Recombinant Protein Antigen (NBP2-69062PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCA12 Products

Array NBP2-69062PEP

Research Areas for ABCA12 Recombinant Protein Antigen (NBP2-69062PEP)

Find related products by research area.

Blogs on ABCA12

There are no specific blogs for ABCA12, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCA12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA12