ABCA12 Antibody

Immunocytochemistry/Immunofluorescence: ABCA12 Antibody [NBP2-69062] - Staining of human cell line hTCEpi shows localization to nucleoli, plasma membrane, cytosol & vesicles. Antibody staining is shown in green.

Product Discontinued

ABCA12 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LRRKGIDDALFKDSEILRKSSNLDKDSSLSFQSTQVPERRHASLATVFPSPSSDLEIPGTYTFNGSQVLARILGLEKLLKQNSTSEDI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCA12
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for ABCA12 Antibody

• ABC12
• ATP-binding cassette 12
• ATP-binding cassette transporter 12
• ATP-binding cassette, sub-family A (ABC1), member 12
• DKFZP434G232
• EC 3.6.3
• EC 3.6.3.25
• FLJ41584
• ichthyosis congenita II, lamellar ichthyosis B
• ICR2B
• LI2ATP-binding cassette sub-family A member 12

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily, which is the only major ABC subfamily found exclusively in multicellular eukaryotes. Alternative splicing of this gene results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCA12