AAVR/KIAA0319L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AAVR/KIAA0319L Antibody [NBP2-57263] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AAVR/KIAA0319L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KRKSKYKILDATDQESLELKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNGSVPNGQ
Specificity
Specificity of human KIAA0319L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0319L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AAVR/KIAA0319L Antibody

  • AAV Receptor
  • AAVR
  • FLJ44532
  • KIAA0319L
  • KIAA0319-like
  • KIAA1837
  • KIAA1837dyslexia-associated protein KIAA0319-like protein
  • polycystic kidney disease 1-related

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93472
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1440
Species: Mu
Applications: WB
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu, Mu, Rt, Bv, Ca, GP, Rb, Ze
Applications: WB
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-88227
Species: Hu
Applications: WB, IHC, IHC-P
MAB49281
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-88191
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009732-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-13350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56909
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-90010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
NBP2-57263
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for AAVR/KIAA0319L Antibody (NBP2-57263) (0)

There are no publications for AAVR/KIAA0319L Antibody (NBP2-57263).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AAVR/KIAA0319L Antibody (NBP2-57263) (0)

There are no reviews for AAVR/KIAA0319L Antibody (NBP2-57263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AAVR/KIAA0319L Antibody (NBP2-57263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AAVR/KIAA0319L Products

Bioinformatics Tool for AAVR/KIAA0319L Antibody (NBP2-57263)

Discover related pathways, diseases and genes to AAVR/KIAA0319L Antibody (NBP2-57263). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AAVR/KIAA0319L Antibody (NBP2-57263)

Discover more about diseases related to AAVR/KIAA0319L Antibody (NBP2-57263).
 

Pathways for AAVR/KIAA0319L Antibody (NBP2-57263)

View related products by pathway.

Blogs on AAVR/KIAA0319L

There are no specific blogs for AAVR/KIAA0319L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AAVR/KIAA0319L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0319L