AATF Antibody (2H6) Summary
Immunogen |
AATF (AAH00591, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT |
Specificity |
AATF (2H6) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
AATF |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Immunocytochemistry/Immunofluorescence
- Sandwich ELISA
|
Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
Control |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for AATF Antibody (2H6)
Background
The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Ma
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Po, Am, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Publications for AATF Antibody (H00026574-M09) (0)
There are no publications for AATF Antibody (H00026574-M09).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AATF Antibody (H00026574-M09) (0)
There are no reviews for AATF Antibody (H00026574-M09).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AATF Antibody (H00026574-M09) (0)
Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional AATF Products
Bioinformatics Tool for AATF Antibody (H00026574-M09)
Discover related pathways, diseases and genes to AATF Antibody (H00026574-M09). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for AATF Antibody (H00026574-M09)
Discover more about diseases related to AATF Antibody (H00026574-M09).
| | Pathways for AATF Antibody (H00026574-M09)
View related products by pathway.
|
PTMs for AATF Antibody (H00026574-M09)
Learn more about PTMs related to AATF Antibody (H00026574-M09).
| | Research Areas for AATF Antibody (H00026574-M09)
Find related products by research area.
|
Blogs on AATF