A-Myb Antibody - BSA Free

Western Blot: A-Myb Antibody [NBP2-86995] - WB Suggested Anti-MYBL1 Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysate

Immunohistochemistry: A-Myb Antibody [NBP2-86995] - Human kidney

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

A-Myb Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit A-Myb Antibody - BSA Free (NBP2-86995) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human A-Myb. Peptide sequence: PRTPTPFKNALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLFLK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYBL1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for A-Myb Antibody - BSA Free

• A-MYB
• AMYBMGC120059
• MGC120061
• Myb-like protein 1
• myb-related protein A
• v-myb avian myeloblastosis viral oncogene homolog-like 1
• v-myb myeloblastosis viral oncogene homolog (avian)-like 1

Background

Strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYBL1