58K Golgi Protein Antibody - BSA Free

Immunohistochemistry analysis in human liver and skeletal muscle tissues using HPA020073 antibody. Corresponding FTCD RNA-seq data are presented for the same tissues.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human skin shows no positivity in squamous epithelial cells as expected.

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

58K Golgi Protein Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit 58K Golgi Protein Antibody - BSA Free (NBP1-86031) is a polyclonal antibody validated for use in IHC and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MRLPKNIPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWLALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRV
• Marker: Golgi Apparatus Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FTCD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Simple Western
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  58K Golgi Protein Protein (NBP1-86031PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for 58K Golgi Protein Antibody - BSA Free

• formimidoyltransferase cyclodeaminase
• formimidoyltransferase-cyclodeaminase
• formiminotransferase cyclodeaminase
• Formiminotransferase-cyclodeaminase
• human formiminotransferase cyclodeaminase, EC 4.3.1.410formiminotransferase-cyclodeaminase
• LCHC1

Background

58K protein antibodies are excellent for use as markers for the Golgi complex. The 58K protein has been identified as being FTCD, a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. Defects in FTCD are the cause of glutamate formiminotransferase deficiency; also known as formiminoglutamicaciduria (FIGLU-uria). It is an autosomal recessive disorder. Features of a severe phenotype, include elevated levels of formiminoglutamate (FIGLU) in the urine in response to histidine administration, megaloblastic anemia, and mental retardation. Features of a mild phenotype include high urinary excretion of FIGLU in the absence of histidine administration, mild developmental delay, and no hematological abnormalities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FTCD