Recombinant Human 53BP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human 53BP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 511-610 of Human TP53BP2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TP53BP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 53BP2 Protein

  • apoptosis-stimulating protein of p53, 2
  • ASPP2P53BP2,53BP2apoptosis-stimulating of p53 protein 2
  • Bbp
  • Bcl2-binding protein
  • p53-binding protein 2
  • p53BP2
  • PPP1R13A
  • Renal carcinoma antigen NY-REN-51
  • tumor protein p53 binding protein, 2
  • tumor protein p53-binding protein, 2
  • Tumor suppressor p53-binding protein 2

Background

TP53BP2 - tumor protein p53 binding protein, 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-48732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
H00051426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for 53BP2 Partial Recombinant Protein (H00007159-Q01) (0)

There are no publications for 53BP2 Partial Recombinant Protein (H00007159-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 53BP2 Partial Recombinant Protein (H00007159-Q01) (0)

There are no reviews for 53BP2 Partial Recombinant Protein (H00007159-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 53BP2 Partial Recombinant Protein (H00007159-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 53BP2 Products

Bioinformatics Tool for 53BP2 Partial Recombinant Protein (H00007159-Q01)

Discover related pathways, diseases and genes to 53BP2 Partial Recombinant Protein (H00007159-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 53BP2 Partial Recombinant Protein (H00007159-Q01)

Discover more about diseases related to 53BP2 Partial Recombinant Protein (H00007159-Q01).
 

Pathways for 53BP2 Partial Recombinant Protein (H00007159-Q01)

View related products by pathway.

PTMs for 53BP2 Partial Recombinant Protein (H00007159-Q01)

Learn more about PTMs related to 53BP2 Partial Recombinant Protein (H00007159-Q01).
 

Research Areas for 53BP2 Partial Recombinant Protein (H00007159-Q01)

Find related products by research area.

Blogs on 53BP2

There are no specific blogs for 53BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

53BP2 Antibody
NB100-2859

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 53BP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TP53BP2