53BP2 Antibody (3F8)

Images

 
Western Blot: 53BP2 Antibody (3F8) [H00007159-M01] - TP53BP2 monoclonal antibody (M01), clone 3F8 Analysis of TP53BP2 expression in HepG2.
Immunohistochemistry-Paraffin: 53BP2 Antibody (3F8) [H00007159-M01] - Analysis of monoclonal antibody to TP53BP2 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Sandwich ELISA: 53BP2 Antibody (3F8) [H00007159-M01] - Detection limit for recombinant GST tagged TP53BP2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

53BP2 Antibody (3F8) Summary

Immunogen
TP53BP2 (AAH58918 511 a.a. - 610 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TP53BP2
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Positive Control
53BP2 Lysate (NBP2-65091)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 53BP2 Antibody (3F8)

  • apoptosis-stimulating protein of p53, 2
  • ASPP2P53BP2,53BP2apoptosis-stimulating of p53 protein 2
  • Bbp
  • Bcl2-binding protein
  • p53-binding protein 2
  • p53BP2
  • PPP1R13A
  • Renal carcinoma antigen NY-REN-51
  • tumor protein p53 binding protein, 2
  • tumor protein p53-binding protein, 2
  • Tumor suppressor p53-binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-48732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
H00051426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
DDX0450P-100
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr

Publications for 53BP2 Antibody (H00007159-M01) (0)

There are no publications for 53BP2 Antibody (H00007159-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 53BP2 Antibody (H00007159-M01) (0)

There are no reviews for 53BP2 Antibody (H00007159-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 53BP2 Antibody (H00007159-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for 53BP2 Antibody (H00007159-M01)

Discover related pathways, diseases and genes to 53BP2 Antibody (H00007159-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 53BP2 Antibody (H00007159-M01)

Discover more about diseases related to 53BP2 Antibody (H00007159-M01).
 

Pathways for 53BP2 Antibody (H00007159-M01)

View related products by pathway.

PTMs for 53BP2 Antibody (H00007159-M01)

Learn more about PTMs related to 53BP2 Antibody (H00007159-M01).
 

Research Areas for 53BP2 Antibody (H00007159-M01)

Find related products by research area.

Blogs on 53BP2

There are no specific blogs for 53BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 53BP2 Antibody (3F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TP53BP2