5-HT7 Antibody (4E6D2) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 5-HT7 (P34969). MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNC |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
HTR7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for 5-HT7 Antibody (4E6D2)
Background
Receptors for serotonin (5-hydroxytryptamine, 5-HT) are classified into seven major classes (5-HTR1-7), based on structural, functional and pharmacological criteria (Hoyer et al, 1994). The 5-HT7 receptor (5-HT7R) is a seven-transmembrane-domain G-protein-coupled receptor that has important roles in regulating diverse biological process in the central and peripheral nervous systems (reviewed in Hedlund and Sutcliffe, 2004). Receptors for serotonin (5-hydroxytryptamine, 5-HT) are classified into seven major classes (5-HT1-7), based on structural, functional and pharmacological criteria (Hoyer et al, 1994). Sequence alignment shows a high degree of interspecies 5-HT7R homology (>90%), and a low homology with other 5-HTRs (
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Pm
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Publications for 5-HT7 Antibody (NBP3-15870) (0)
There are no publications for 5-HT7 Antibody (NBP3-15870).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for 5-HT7 Antibody (NBP3-15870) (0)
There are no reviews for 5-HT7 Antibody (NBP3-15870).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for 5-HT7 Antibody (NBP3-15870) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional 5-HT7 Products
Research Areas for 5-HT7 Antibody (NBP3-15870)
Find related products by research area.
|
Blogs on 5-HT7