5-HT7 Antibody (4E6D2)

Western Blot: 5-HT7 Antibody (4E6D2) [NBP3-15870] - Analysis of extracts of various cell lines, using 5-HT7 Rabbit mAb (NBP3-15870) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: 5-HT7 Antibody (4E6D2) [5-HT7] - Confocal imaging of paraffin-embedded Rat brain using 5-HT7 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: 5-HT7 Antibody (4E6D2) [5-HT7] - Confocal imaging of paraffin-embedded Mouse brain using 5-HT7 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 4E6D2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

5-HT7 Antibody (4E6D2) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 5-HT7 (P34969). MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNC
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HTR7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for 5-HT7 Antibody (4E6D2)

• 5HT7
• 5-HT7
• 5-HT-7
• 5-HT75-hydroxytryptamine receptor 7
• 5-HT-X
• 5-hydroxytryptamine (serotonin) receptor 7 (adenylate cyclase-coupled)
• HTR7
• serotonin 5-HT-7 receptor
• Serotonin receptor 7

Background

Receptors for serotonin (5-hydroxytryptamine, 5-HT) are classified into seven major classes (5-HTR1-7), based on structural, functional and pharmacological criteria (Hoyer et al, 1994). The 5-HT7 receptor (5-HT7R) is a seven-transmembrane-domain G-protein-coupled receptor that has important roles in regulating diverse biological process in the central and peripheral nervous systems (reviewed in Hedlund and Sutcliffe, 2004). Receptors for serotonin (5-hydroxytryptamine, 5-HT) are classified into seven major classes (5-HT1-7), based on structural, functional and pharmacological criteria (Hoyer et al, 1994). Sequence alignment shows a high degree of interspecies 5-HT7R homology (>90%), and a low homology with other 5-HTRs (

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTR7