Recombinant Human 5-HT5A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human 5-HT5A Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 357 of Human HTR5A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH

Protein/Peptide Type
Recombinant Protein
Gene
HTR5A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5-HT5A Protein

  • 5HT5A
  • 5-HT5A
  • 5-HT-5A
  • 5-HT5A5-hydroxytryptamine receptor 5A
  • 5-hydroxytryptamine (serotonin) receptor 5A
  • HTR5A
  • MGC138226,5-HT-5
  • Serotonin receptor 5A

Background

The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-55429
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-56349
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-90320
Species: Hu
Applications: WB, IHC, IHC-P
AF5276
Species: Hu
Applications: WB, IHC
NB100-56351
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
H00003361-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for 5-HT5A Recombinant Protein (H00003361-P01) (0)

There are no publications for 5-HT5A Recombinant Protein (H00003361-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT5A Recombinant Protein (H00003361-P01) (0)

There are no reviews for 5-HT5A Recombinant Protein (H00003361-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5-HT5A Recombinant Protein (H00003361-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-HT5A Products

Bioinformatics Tool for 5-HT5A Recombinant Protein (H00003361-P01)

Discover related pathways, diseases and genes to 5-HT5A Recombinant Protein (H00003361-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT5A Recombinant Protein (H00003361-P01)

Discover more about diseases related to 5-HT5A Recombinant Protein (H00003361-P01).
 

Pathways for 5-HT5A Recombinant Protein (H00003361-P01)

View related products by pathway.

Research Areas for 5-HT5A Recombinant Protein (H00003361-P01)

Find related products by research area.

Blogs on 5-HT5A

There are no specific blogs for 5-HT5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

5-HT7 Antibody
NB100-56352
5-HT5A Antibody (3D1)
H00003361-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 5-HT5A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR5A
Entrez