Recombinant Human 5-HT2C Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human 5-HT2C Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-52 of Human 5-HT2C

Source: Wheat Germ

Amino Acid Sequence: MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HTR2C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
31.46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5-HT2C Protein

  • 5-HT1C
  • 5-HT-1C
  • 5HT2C
  • 5-HT2C
  • 5-HT-2C
  • 5-HT2C5-hydroxytryptamine receptor 1C
  • 5-HTR2C
  • 5-hydroxytryptamine (serotonin) receptor 2C
  • 5-hydroxytryptamine receptor 2C
  • HTR1C
  • HTR2C
  • serotonin 5-HT-2C receptor
  • Serotonin Receptor 2C

Background

HTR2C - 5-hydroxytryptamine (serotonin) receptor 2C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB100-56349
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-55429
Species: Hu, Mu
Applications: WB, ICC/IF
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP1-00178
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for 5-HT2C Partial Recombinant Protein (H00003358-Q01) (0)

There are no publications for 5-HT2C Partial Recombinant Protein (H00003358-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT2C Partial Recombinant Protein (H00003358-Q01) (0)

There are no reviews for 5-HT2C Partial Recombinant Protein (H00003358-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5-HT2C Partial Recombinant Protein (H00003358-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for 5-HT2C Partial Recombinant Protein (H00003358-Q01)

Discover related pathways, diseases and genes to 5-HT2C Partial Recombinant Protein (H00003358-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT2C Partial Recombinant Protein (H00003358-Q01)

Discover more about diseases related to 5-HT2C Partial Recombinant Protein (H00003358-Q01).
 

Pathways for 5-HT2C Partial Recombinant Protein (H00003358-Q01)

View related products by pathway.

PTMs for 5-HT2C Partial Recombinant Protein (H00003358-Q01)

Learn more about PTMs related to 5-HT2C Partial Recombinant Protein (H00003358-Q01).
 

Research Areas for 5-HT2C Partial Recombinant Protein (H00003358-Q01)

Find related products by research area.

Blogs on 5-HT2C

There are no specific blogs for 5-HT2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

5-HT7 Antibody
NB100-56352
POMC Antibody
NB100-1533
5-HT2B Antibody
NBP1-55429

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 5-HT2C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR2C
Entrez