Recombinant Human 5-HT2C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human 5-HT2C Protein Summary

Description
5-HT2C (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV
Protein/Peptide Type
Partial Recombinant Protein
Gene
HTR2C

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5-HT2C Protein

  • 5-HT1C
  • 5-HT-1C
  • 5HT2C
  • 5-HT2C
  • 5-HT-2C
  • 5-HT2C5-hydroxytryptamine receptor 1C
  • 5-HTR2C
  • 5-hydroxytryptamine (serotonin) receptor 2C
  • 5-hydroxytryptamine receptor 2C
  • HTR1C
  • HTR2C
  • serotonin 5-HT-2C receptor
  • Serotonin Receptor 2C

Background

HTR2C - 5-hydroxytryptamine (serotonin) receptor 2C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB100-56349
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-55429
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-78989
Species: Mu, Rt
Applications: WB (-), IHC
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for 5-HT2C Partial Recombinant Protein (H00003358-Q01) (0)

There are no publications for 5-HT2C Partial Recombinant Protein (H00003358-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT2C Partial Recombinant Protein (H00003358-Q01) (0)

There are no reviews for 5-HT2C Partial Recombinant Protein (H00003358-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5-HT2C Partial Recombinant Protein (H00003358-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-HT2C Products

Bioinformatics Tool for 5-HT2C Partial Recombinant Protein (H00003358-Q01)

Discover related pathways, diseases and genes to 5-HT2C Partial Recombinant Protein (H00003358-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT2C Partial Recombinant Protein (H00003358-Q01)

Discover more about diseases related to 5-HT2C Partial Recombinant Protein (H00003358-Q01).
 

Pathways for 5-HT2C Partial Recombinant Protein (H00003358-Q01)

View related products by pathway.

PTMs for 5-HT2C Partial Recombinant Protein (H00003358-Q01)

Learn more about PTMs related to 5-HT2C Partial Recombinant Protein (H00003358-Q01).
 

Research Areas for 5-HT2C Partial Recombinant Protein (H00003358-Q01)

Find related products by research area.

Blogs on 5-HT2C

There are no specific blogs for 5-HT2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

5-HT7 Antibody
NB100-56352
POMC Antibody
NB100-1533
POMC Antibody
NB100-1533
5-HT1B Antibody
NB100-56350

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 5-HT2C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR2C
Entrez