5-HT2B Antibody - BSA Free

Western Blot: 5-HT2B Antibody [NBP1-55429] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Immunocytochemistry/Immunofluorescence: 5-HT2B Antibody [NBP1-55429] - Spinal Cord, ventral horns of mouse, 1.3ug/mL Image Submitted By: Timur Mavlyutov, PhD Department of Pharmacology University of Wisconsin Medical School

Western Blot: 5-HT2B Antibody [NBP1-55429] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Western Blot: 5-HT2B Antibody [NBP1-55429] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: 5-HT2B Antibody [NBP1-55429] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

5-HT2B Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to HTR2B(5-hydroxytryptamine (serotonin) receptor 2B) Antibody(against the N terminal of 5HT2B Receptor. Peptide sequence: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTR2B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Western Blot 1.0 ug/ml
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for 5-HT2B Antibody - BSA Free

• 5-HT(2B)
• 5HT2B
• 5-HT2B
• 5-HT-2B
• 5-HT2B5-HT 2B receptor
• 5-hydroxytryptamine (serotonin) receptor 2B
• 5-hydroxytryptamine 2B receptor
• 5-hydroxytryptamine receptor 2B
• HTR2B
• Serotonin receptor 2B

Background

5-HT2B, a Serotonin Receptor, activates phospholipase C upon binding serotonin, which results in a rise in intracellular calcium. It is known that 5-HT2B regulates cardiovascular function during development and in adulthood; mice lacking functional 5-HT2B receptors died of heart defects during gestation or neonatally, and adult mutant mice displayed cardiopathy, including myocyte disarray and ventricular dilation. Abnormal vascular proliferation causes an increase in pulmonary blood pressure, which is associated with an increase in 5-HT2B receptor, resulting in the development of pulmonary hypertension. It has also been reported that the 5-HT2B is involved in cell-cycle regulation via interaction with tyrosine kinase pathways. 5-HT2B receptors may have a role in the initiation of migraine headaches, and selective antagonists may prove therapeutic in migraine treatment. 5-HT2B receptor is expressed in many tissues including human liver, kidney, lung, heart, pancreas, spleen, brain, spinal cord, gastrointestinal tract, placenta, and coronary and pulmonary arteries. It has also been reported in embryonic mouse heart and spinal cord. ESTs have been isolated from heart/melanocyte/uterus, kidney, prostate, skin, and thyroid libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for 5-HT2B Antibody (NBP1-55429)(1)

Publication using NBP1-55429

• Lee SH, Cho PS, Tonello R et al. Peripheral serotonin receptor 2B and transient receptor potential channel 4 mediate pruritus to serotonergic antidepressants in mice. J. Allergy Clin. Immunol. 2018-06-18 [PMID: 29920354] (WB, Mouse)

Bioinformatics

• Gene Symbol: HTR2B
• Entrez:
  • 3357(Human)
• Uniprot:
  • P41595()