5-HT2A Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related 5-HT2A Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-90318PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

5-HT2A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HTR2A.

Source: E. coli

Amino Acid Sequence: TIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HTR2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90318.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 5-HT2A Recombinant Protein Antigen

  • 5-HT2 receptor
  • 5-HT-2
  • 5HT2A
  • 5-HT2A
  • 5-HT-2A
  • 5-hydroxytryptamine (serotonin) receptor 2A
  • 5-hydroxytryptamine receptor 2A
  • HTR2,5-HT2A
  • HTR2A
  • serotonin 5-HT-2A receptor
  • Serotonin receptor 2A

Background

The 5HT2A Receptor gene encodes one of the receptors for serotonin, a neurotransmitter with many roles. Mutations in this gene areassociated with susceptibility to schizophrenia and obsessive-compulsive disorder, and are also associated withresponse to the antidepressant citalopram in patients with major depressive disorder (MDD). MDD patients who also havea mutation in intron 2 of this gene show a significantly reduced response to citalopram as this antidepressantdownregulates expression of this gene. Multiple transcript variants encoding different isoforms have been found forthis gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21590
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, Simple Western, WB
MAB5764
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP1-55429
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-78403
Species: Hu
Applications: ICC/IF, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC,  IHC-P, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56352
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP1-46557
Species: Mu, Rt
Applications: IHC, WB
NBP1-90318PEP
Species: Hu
Applications: AC

Publications for 5-HT2A Protein (NBP1-90318PEP) (0)

There are no publications for 5-HT2A Protein (NBP1-90318PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT2A Protein (NBP1-90318PEP) (0)

There are no reviews for 5-HT2A Protein (NBP1-90318PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 5-HT2A Protein (NBP1-90318PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-HT2A Products

Array NBP1-90318PEP

Research Areas for 5-HT2A Protein (NBP1-90318PEP)

Find related products by research area.

Blogs on 5-HT2A

There are no specific blogs for 5-HT2A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 5-HT2A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR2A