Recombinant Human 14-3-3 eta Protein

Product Discontinued

Recombinant Human 14-3-3 eta Protein Summary

• Description: A full-length recombinant protein with His tag corresponding to the amino acids 1 - 246 of Human YWHAH
  
  

  Source: Escherichia coli

  Amino Acid Sequence:MGSSHHHHHHSSGLVPRGSHMGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

• Preparation Method: Escherichia coli expression system
• Protein/Peptide Type: Recombinant Protein
• Gene: YWHAH

Applications/Dilutions

• Dilutions:
  • SDS-Page
• Application Notes: This product is useful for SDS-PAGE.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: In 20 mM Tris pH 8.0
• Preservative: No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 14-3-3 eta Protein

• 1433 eta
• 14-3-3 eta
• 14-3-3 protein eta
• Protein AS1
• tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, etapolypeptide
• YWHA1
• YWHA114-3-3 eta
• YWHAH

Background

Members of the 14-3-3 family of proteins are highly conserved proteins, localized in neurons, and are axonally transported to the nerve terminals. They are also present, at lower levels, in various other eukaryotic tissues. 14-3-3 proteins appear to play important roles in a variety of signal transduction pathways, including those involved in cell cycle regulation and cell survival. Because 14-3-3 proteins bind to specific phosphoserine-containing sequences they are likely to have an important role in signaling pathways mediated by serine/threonine protein kinases. Evidence indicates 14-3-3 is required for Raf 1 kinase activity and phosphorylation among many other functions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: YWHAH