Melusin/ITGB1BP2 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:ISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLA |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ITGB1BP2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:50-1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Melusin/ITGB1BP2 Antibody
Background
ITGB1BP2 is a gene which codes for a protein that is expressed in skeletal and cardiac muscles that may play a role during the organization and maturation of muscle cells and is comprised of 347 amino acids, weighing approximately 38 kDa. Studies are being conducted on diseases and disorders relating to this gene including muscular dystrophy, cardiomyopathy, hypertension and hypertrophy. ITGB1BP2 has also been shown to have interactions with EDC, SUGT1, HSP90AA1, RARA, and RARG.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: ChHa, Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Pm-Cm, Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: ICC/IF, IHC
Publications for Melusin/ITGB1BP2 Antibody (NBP1-84481) (0)
There are no publications for Melusin/ITGB1BP2 Antibody (NBP1-84481).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Melusin/ITGB1BP2 Antibody (NBP1-84481) (0)
There are no reviews for Melusin/ITGB1BP2 Antibody (NBP1-84481).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Melusin/ITGB1BP2 Antibody (NBP1-84481) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Melusin/ITGB1BP2 Products
Research Areas for Melusin/ITGB1BP2 Antibody (NBP1-84481)
Find related products by research area.
|
Blogs on Melusin/ITGB1BP2