![Western Blot: DPY30 Antibody [45110002] - This image is specific to animal number SDQ3499 Dilution: 1:1000 Secondary antibody was donkey-anti-rabbit-HRP from GE Healthcare in 1:10000 dilution of anti-tubulin was carried out on the stripped membrane. Protein extracts from mixed stage rrf-3 worms fed bateria containing either an empty RNAi vector (left lane), a RNAi vector targetting DPY-30 (middle lane), or an OP-50 bacterial control (right lane). The antibody targets one protein with a size of 12.8 kDa](http://images.novusbio.com/fullsize/DPY30-Antibody-Western-Blot-45110002-img0004.jpg "Western Blot: DPY30 Antibody [45110002] - This image is specific to animal number SDQ3499 Dilution: 1:1000 Secondary antibody was donkey-anti-rabbit-HRP from GE Healthcare in 1:10000 dilution of anti-tubulin was carried out on the stripped membrane. Protein extracts from mixed stage rrf-3 worms fed bateria containing either an empty RNAi vector (left lane), a RNAi vector targetting DPY-30 (middle lane), or an OP-50 bacterial control (right lane). The antibody targets one protein with a size of 12.8 kDa")
| Immunogen | In vivo generated recombinant protein fragme |
| Epitope | APAASAAAPAEAESNENTTVPSNVLSANGGQQTGNQSAPRNTSTVPTRQYLDSTVVPILLQGLGALAKDRPENPIEFLANFLLREKDRYNAENQNPAGQQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DPY30 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This product is useful for ELISA, Western Blot, and Immunofluorescence. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative | No Preservative |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DPY30 Antibody (45110002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: DPY30 Antibody [45110002] - This image is specific to animal number SDQ3495 Dilution: 1:1000 Secondary antibody was donkey-anti-rabbit-HRP from GE Healthcare in 1:10000 dilution. As a control, a western with 1:10000 dilution of anti-tubulin was carried out on the stripped membrane. Protein extracts from mixed stage rrf-3 worms fed bacteria containing either an empty RNAi vector (left lane), a RNAi vector targetting DPY-30 (middle lane), or an OP-50 bacterial control (right lane). The antibody targets one protein with a size of 12.8 kDa](http://images.novusbio.com/fullsize/DPY30-Antibody-Western-Blot-45110002-img0003.jpg "Western Blot: DPY30 Antibody [45110002] - This image is specific to animal number SDQ3495 Dilution: 1:1000 Secondary antibody was donkey-anti-rabbit-HRP from GE Healthcare in 1:10000 dilution. As a control, a western with 1:10000 dilution of anti-tubulin was carried out on the stripped membrane. Protein extracts from mixed stage rrf-3 worms fed bacteria containing either an empty RNAi vector (left lane), a RNAi vector targetting DPY-30 (middle lane), or an OP-50 bacterial control (right lane). The antibody targets one protein with a size of 12.8 kDa")
![Western Blot WDR5 Antibody [Unconjugated]](https://images.novusbio.com/images2/WDR5_AF5810_Western_Blot_5854.jpg)
![Immunohistochemistry WDR5 Antibody [Unconjugated]](https://images.novusbio.com/images2/WDR5_AF5810_Immunohistochemistry_21711.jpg)
![Immunocytochemistry/ Immunofluorescence WDR5 Antibody [Unconjugated]](https://images.novusbio.com/images/af5810_human-mouse-wdr5-affinity-purified-polyclonal-ab-41202412401254.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
