Novus Biologicals products are now on bio-techne.com

ZWINT Recombinant Protein Antigen

Images

 
There are currently no images for ZWINT Protein (NBP1-82868PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZWINT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZWINT.

Source: E. coli

Amino Acid Sequence: ILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZWINT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82868.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZWINT Recombinant Protein Antigen

  • C20orf164
  • chromosome 20 open reading frame 164
  • dJ337O18.7
  • zinc finger SWIM domain-containing protein 3
  • zinc finger, SWIM domain containing 3
  • zinc finger, SWIM-type containing 3

Background

ZWINT encodes a protein that is clearly involved in kinetochore function although an exact role is not known. It interacts with ZW10, another kinetochore protein, possibly regulating the association between ZW10 and kinetochores. The encoded protein localizes to prophase kinetochores before ZW10 does and it remains detectable on the kinetochore until late anaphase. It has a uniform distribution in the cytoplasm of interphase cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38751
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2359
Species: Hu
Applications: IHC, IP, WB
NB100-338
Species: Ha, Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
NB100-2586
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-21057
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00795
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP1-82312
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83032
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-91348
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NB500-101
Species: Bv, Eq, Hu, Mu
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP2-47264
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85277
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-49142
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-82868PEP
Species: Hu
Applications: AC

Publications for ZWINT Protein (NBP1-82868PEP) (0)

There are no publications for ZWINT Protein (NBP1-82868PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZWINT Protein (NBP1-82868PEP) (0)

There are no reviews for ZWINT Protein (NBP1-82868PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZWINT Protein (NBP1-82868PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZWINT Products

Research Areas for ZWINT Protein (NBP1-82868PEP)

Find related products by research area.

Blogs on ZWINT

There are no specific blogs for ZWINT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZWINT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZWINT