ZPBP Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human ZPBP (NP_008940.2). HLVRLPRAFRLTKDSVKIVGSTSFPVKAYVMLHQKSPHVLCVTQQLRNAELIDPSFQWYGPKGKVVSVENRTAQITSTGSLVFQNFEESMSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYYQFTARYHAAPCNSIYNISFEKKLLQILSK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ZPBP |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Immunohistochemistry 1:50-1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500-1:2000
|
| Theoretical MW |
40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for ZPBP Antibody - Azide and BSA Free
Background
ZPBP is one of several proteins that are thought to participate in secondary binding between acrosome-reacted sperm and the egg-specific extracellular matrix, the zona pellucida (McLeskey et al., 1998 (PubMed 9378618)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Pm-Cm, Hu, RM
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Pm, RM
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ELISA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for ZPBP Antibody (NBP2-93039) (0)
There are no publications for ZPBP Antibody (NBP2-93039).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZPBP Antibody (NBP2-93039) (0)
There are no reviews for ZPBP Antibody (NBP2-93039).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZPBP Antibody (NBP2-93039) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZPBP Products
Blogs on ZPBP