ZPBP Antibody - BSA Free

Immunohistochemistry-Paraffin: ZPBP Antibody [NBP2-31726] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: ZPBP Antibody [NBP2-31726] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: ZPBP Antibody [NBP2-31726] - Staining in human testis and endometrium tissues using anti-ZPBP antibody. Corresponding ZPBP RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZPBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZPBP Antibody - BSA Free (NBP2-31726) is a polyclonal antibody validated for use in IHC. Anti-ZPBP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLDTEKGPKRCTDHNCEPYKRLFKAKNLIERFFNQQVEILG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZPBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZPBP Recombinant Protein Antigen (NBP2-31726PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%). Reactivity reported in scientific literature (PMID: 24309898)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZPBP Antibody - BSA Free

• Iam38
• KIAA0395TIX1
• Sp38
• triple homeobox 1
• Triple homeobox protein 1
• Zinc finger and homeodomain protein 3
• zinc fingers and homeoboxes 3
• zinc fingers and homeoboxes protein 3
• ZPBP
• ZPBP1

Background

ZPBP is one of several proteins that are thought to participate in secondary binding between acrosome-reacted sperm and the egg-specific extracellular matrix, the zona pellucida (McLeskey et al., 1998 (PubMed 9378618)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZPBP Antibody (NBP2-31726)(1)

Publication using NBP2-31726

• Fagerberg L, Hallstrom BM, Oksvold P et al. Analysis of the Human Tissue-specific Expression by Genome-wide Integration of Transcriptomics and Antibody-based Proteomics. Mol Cell Proteomics 2014-02-01 [PMID: 24309898]

Bioinformatics

• Gene Symbol: ZPBP
• Uniprot:
  • Q9BS86(Human)