ZPBP Antibody

Images

 
Immunohistochemistry-Paraffin: ZPBP1 Antibody [NBP2-31726] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZPBP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLDTEKGPKRCTDHNCEPYKRLFKAKNLIERFFNQQVEILG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZPBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZPBP Recombinant Protein Antigen (NBP2-31726PEP)
Publications
Read Publication using NBP2-31726.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%). Reactivity reported in scientific literature (PMID: 24309898)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZPBP Antibody

  • Iam38
  • KIAA0395TIX1
  • Sp38
  • triple homeobox 1
  • Triple homeobox protein 1
  • Zinc finger and homeodomain protein 3
  • zinc fingers and homeoboxes 3
  • zinc fingers and homeoboxes protein 3
  • ZPBP
  • ZPBP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82689
Species: Hu
Applications: WB, IHC, IHC-P
NB120-3420
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-86823
Species: Hu
Applications: IHC, IHC-P
NBP1-85409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-52645
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, CyTOF-ready
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-85407
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45844
Species: Hu
Applications: WB, IHC
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NBP2-31726
Species: Hu
Applications: IHC, IHC-P

Publications for ZPBP Antibody (NBP2-31726)(1)

Reviews for ZPBP Antibody (NBP2-31726) (0)

There are no reviews for ZPBP Antibody (NBP2-31726). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZPBP Antibody (NBP2-31726) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZPBP Products

Bioinformatics Tool for ZPBP Antibody (NBP2-31726)

Discover related pathways, diseases and genes to ZPBP Antibody (NBP2-31726). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZPBP Antibody (NBP2-31726)

Discover more about diseases related to ZPBP Antibody (NBP2-31726).
 

Pathways for ZPBP Antibody (NBP2-31726)

View related products by pathway.

Blogs on ZPBP

There are no specific blogs for ZPBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZPBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZPBP
Entrez
Uniprot