Recombinant Human ZNHIT2 Protein

Images

 
SDS-Page: Recombinant Human ZNHIT2 Protein [H00000741-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNHIT2 Protein Summary

Description
ZNHIT2 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GEHPPGPLGTRGAMHEVARILLGEGPTNQKGYTLAALGDLAQTLGRARKQAVAREERDHLYRARKKCQFLLAWTNENEAALTPLALDC
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNHIT2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNHIT2 Protein

  • C11orf5zinc finger HIT domain-containing protein 2
  • chromosome 11 open reading frame 5
  • FONMGC120286
  • MGC120285
  • Protein FON
  • zinc finger, HIT domain containing 2
  • zinc finger, HIT type 2
  • zinc finger, HIT-type containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-43123
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, CyTOF-ready
NBP1-55090
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00009326-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NBP1-89910
Species: Hu
Applications: IHC, IHC-P
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF3025
Species: Hu
Applications: WB, ICC
302-B2/CF
Species: Hu
H00000741-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNHIT2 Partial Recombinant Protein (H00000741-Q01) (0)

There are no publications for ZNHIT2 Partial Recombinant Protein (H00000741-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNHIT2 Partial Recombinant Protein (H00000741-Q01) (0)

There are no reviews for ZNHIT2 Partial Recombinant Protein (H00000741-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNHIT2 Partial Recombinant Protein (H00000741-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNHIT2 Products

Bioinformatics Tool for ZNHIT2 Partial Recombinant Protein (H00000741-Q01)

Discover related pathways, diseases and genes to ZNHIT2 Partial Recombinant Protein (H00000741-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNHIT2 Partial Recombinant Protein (H00000741-Q01)

Discover more about diseases related to ZNHIT2 Partial Recombinant Protein (H00000741-Q01).
 

Pathways for ZNHIT2 Partial Recombinant Protein (H00000741-Q01)

View related products by pathway.

Blogs on ZNHIT2

There are no specific blogs for ZNHIT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TGF-beta 2
302-B2-002/CF
TGF-beta 2
302-B2-002/CF
ZNHIT2 Antibody
NBP2-15179
ZNHIT2 Antibody
NBP2-15179

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNHIT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNHIT2