ZNHIT2 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

ZNHIT2 Partial Recombinant Protein Summary

Description
ZNHIT2 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GEHPPGPLGTRGAMHEVARILLGEGPTNQKGYTLAALGDLAQTLGRARKQAVAREERDHLYRARKKCQFLLAWTNENEAALTPLALDC
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
ZNHIT2

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNHIT2 Partial Recombinant Protein

  • C11orf5zinc finger HIT domain-containing protein 2
  • chromosome 11 open reading frame 5
  • FONMGC120286
  • MGC120285
  • Protein FON
  • zinc finger, HIT domain containing 2
  • zinc finger, HIT type 2
  • zinc finger, HIT-type containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-43123
Species: Hu
Applications: WB, B/N, ELISA, Flow, ICC/IF
NBP2-32413
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
PP-H1415-00
Species: Hu
Applications: WB, IHC, IP, ChIP, DirELISA, GS
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00009326-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-89910
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-242-PB
Species: Hu
Applications: WB, Flow
AF3025
Species: Hu
Applications: WB, ICC

Publications for ZNHIT2 Partial Recombinant Protein (H00000741-Q01) (0)

There are no publications for ZNHIT2 Partial Recombinant Protein (H00000741-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNHIT2 Partial Recombinant Protein (H00000741-Q01) (0)

There are no reviews for ZNHIT2 Partial Recombinant Protein (H00000741-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNHIT2 Partial Recombinant Protein (H00000741-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNHIT2 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for ZNHIT2 Partial Recombinant Protein (H00000741-Q01)

Discover related pathways, diseases and genes to ZNHIT2 Partial Recombinant Protein (H00000741-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNHIT2 Partial Recombinant Protein (H00000741-Q01)

Discover more about diseases related to ZNHIT2 Partial Recombinant Protein (H00000741-Q01).
 

Pathways for ZNHIT2 Partial Recombinant Protein (H00000741-Q01)

View related products by pathway.

Blogs on ZNHIT2

There are no specific blogs for ZNHIT2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ZNHIT2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00000741-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

ZNHIT2 Recombinant Protein
H00000741-P01-10ug
ZNHIT2 Antibody
NBP2-34096
ZNHIT2 Antibody
NBP2-34096
ZNHIT2 Antibody
NBP2-34096