ZNF85 Antibody (4D12)


There are currently no images for ZNF85 Antibody (H00007639-M04).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

ZNF85 Antibody (4D12) Summary

ZNF85 (NP_003420, 2 a.a. - 76 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT
ZNF85 (4D12)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF85 Antibody (4D12)

  • HPF4
  • HTF1
  • MGC78566
  • zinc finger protein 85 (HPF4, HTF1)
  • zinc finger protein 85
  • Zinc finger protein HPF4
  • Zinc finger protein HTF1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA

Publications for ZNF85 Antibody (H00007639-M04) (0)

There are no publications for ZNF85 Antibody (H00007639-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF85 Antibody (H00007639-M04) (0)

There are no reviews for ZNF85 Antibody (H00007639-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF85 Antibody (H00007639-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF85 Products

Bioinformatics Tool for ZNF85 Antibody (H00007639-M04)

Discover related pathways, diseases and genes to ZNF85 Antibody (H00007639-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF85 Antibody (H00007639-M04)

Discover more about diseases related to ZNF85 Antibody (H00007639-M04).

Pathways for ZNF85 Antibody (H00007639-M04)

View related products by pathway.

Blogs on ZNF85

There are no specific blogs for ZNF85, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF85 Antibody (4D12) and receive a gift card or discount.


Gene Symbol ZNF85