ZNF85 Antibody (4D12) - Azide and BSA Free

Western Blot: ZNF85 Antibody (4D12) [H00007639-M04] - Detection against Immunogen (33.99 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4D12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNF85 Antibody (4D12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ZNF85 (NP_003420, 2 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT
• Specificity: ZNF85 (4D12)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZNF85
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF85 Antibody (4D12) - Azide and BSA Free

• HPF4
• HTF1
• MGC78566
• zinc finger protein 85 (HPF4, HTF1)
• zinc finger protein 85
• Zinc finger protein HPF4
• Zinc finger protein HTF1

Background

ZNF85 is a transcriptional repressor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF85
• Entrez:
  • 7639(Human)
• OMIM:
  • 603899(Human)
• Uniprot:
  • NP_003420(Human)