ZNF77 Antibody - BSA Free

Western Blot: ZNF77 Antibody [NBP2-83904] - WB Suggested Anti-ZNF77 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Hela cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZNF77 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF77 Antibody - BSA Free (NBP2-83904) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF77. Peptide sequence: LCESNEGHQCGETLSQTANLLVHKSYPTEAKPSECTKCGKAFENRQRSHT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF77
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZNF77 Antibody - BSA Free

• pT1
• zinc finger protein 77 (pT1)
• zinc finger protein 77
• ZNFpT1

Background

ZNF77 may be involved in transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF77