ZNF650 Antibody

Images

 
Western Blot: ZNF650 Antibody [NBP1-87996] - Analysis in human cell line K562.
Immunocytochemistry/ Immunofluorescence: ZNF650 Antibody [NBP1-87996] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: ZNF650 Antibody [NBP1-87996] - Staining of human hippocampus shows strong cytoplasmic and nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF650 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF650 Protein (NBP1-87996PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF650 Antibody

  • DKFZp434P117
  • E3 ubiquitin-protein ligase UBR3
  • EC 6.3.2.-
  • FLJ37422
  • KIAA2024DKFZp686N10185
  • MGC126489
  • N-recognin-3
  • ubiquitin protein ligase E3 component n-recognin 3 (putative)
  • Ubiquitin-protein ligase E3-alpha-3
  • Ubiquitin-protein ligase E3-alpha-III
  • Zinc finger protein 650ZNF650

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-45243
Species: Hu, Mu
Applications: WB, IHC-P, PEP-ELISA
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86253
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-59826
Species: Hu
Applications: WB, Simple Western, IP
NBP1-88409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-79358
Species: Hu
Applications: WB
NB100-553
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-31293
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87996
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF650 Antibody (NBP1-87996) (0)

There are no publications for ZNF650 Antibody (NBP1-87996).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF650 Antibody (NBP1-87996) (0)

There are no reviews for ZNF650 Antibody (NBP1-87996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF650 Antibody (NBP1-87996) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF650 Products

Bioinformatics Tool for ZNF650 Antibody (NBP1-87996)

Discover related pathways, diseases and genes to ZNF650 Antibody (NBP1-87996). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF650 Antibody (NBP1-87996)

Discover more about diseases related to ZNF650 Antibody (NBP1-87996).
 

Pathways for ZNF650 Antibody (NBP1-87996)

View related products by pathway.

PTMs for ZNF650 Antibody (NBP1-87996)

Learn more about PTMs related to ZNF650 Antibody (NBP1-87996).
 

Research Areas for ZNF650 Antibody (NBP1-87996)

Find related products by research area.

Blogs on ZNF650

There are no specific blogs for ZNF650, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF650 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBR3