ZNF650 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZNF650 Antibody [NBP1-87996] - Staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ZNF650 Antibody [NBP1-87996] - Staining of human liver shows moderate membranous and cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: ZNF650 Antibody [NBP1-87996] - Staining of human liver shows moderate membranous and cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: ZNF650 Antibody [NBP1-87996] - Staining of human skeletal muscle shows strong cytoplasmic membranous and nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: ZNF650 Antibody [NBP1-87996] - Staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.

Analysis in human cell line K562.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF650 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF650 Antibody - BSA Free (NBP1-87996) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBR3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF650 Protein (NBP1-87996PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNF650 Antibody - BSA Free

• DKFZp434P117
• E3 ubiquitin-protein ligase UBR3
• EC 6.3.2.-
• FLJ37422
• KIAA2024DKFZp686N10185
• MGC126489
• N-recognin-3
• ubiquitin protein ligase E3 component n-recognin 3 (putative)
• Ubiquitin-protein ligase E3-alpha-3
• Ubiquitin-protein ligase E3-alpha-III
• Zinc finger protein 650ZNF650

Background

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearingspecific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination andsubsequent degradation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBR3