UBR7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UBR7 Antibody [NBP1-88409] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: UBR7 Antibody [NBP1-88409] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBR7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEEPAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRPYPDPEDEI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBR7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot reactivity reported in scientific literature (PMID: 25755260).
Control Peptide
UBR7 Protein (NBP1-88409PEP)
Publications
Read Publications using
NBP1-88409 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBR7 Antibody

  • C14orf130
  • chromosome 14 open reading frame 130
  • EC 6.3.2.-
  • FLJ10483
  • MGC9518
  • N-recognin-7
  • putative E3 ubiquitin-protein ligase UBR7
  • ubiquitin protein ligase E3 component n-recognin 7 (putative)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-45243
Species: Hu, Mu
Applications: WB, IHC-P, PEP-ELISA
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-86253
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87996
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59826
Species: Hu
Applications: WB, Simple Western, IP
NB100-553
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-31293
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for UBR7 Antibody (NBP1-88409)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for UBR7 Antibody (NBP1-88409) (0)

There are no reviews for UBR7 Antibody (NBP1-88409). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBR7 Antibody (NBP1-88409) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBR7 Products

Bioinformatics Tool for UBR7 Antibody (NBP1-88409)

Discover related pathways, diseases and genes to UBR7 Antibody (NBP1-88409). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBR7 Antibody (NBP1-88409)

Discover more about diseases related to UBR7 Antibody (NBP1-88409).
 

Pathways for UBR7 Antibody (NBP1-88409)

View related products by pathway.

PTMs for UBR7 Antibody (NBP1-88409)

Learn more about PTMs related to UBR7 Antibody (NBP1-88409).

Blogs on UBR7

There are no specific blogs for UBR7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBR7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBR7