ZNF592 Antibody - BSA Free

Western Blot: ZNF592 Antibody [NBP3-11016] - Western blot analysis of ZNF592 in Human 293T Whole Cell lysates. Antibody dilution at 2ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZNF592 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF592 Antibody - BSA Free (NBP3-11016) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF592 (NP_055445). Peptide sequence FSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFP
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF592
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 139 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZNF592 Antibody - BSA Free

• CAMOS
• KIAA0211MGC138437
• MGC138439
• SCAR5
• spinocerebellar ataxia, autosomal recessive 5
• zinc finger protein 592

Background

ZNF592 is a zinc-finger protein that belongs to the krueppel C2H2-type zinc-finger family of proteins. ZNF592 bears 13 C2H2-type zinc-fingers and is hypothesized to function as a transcriptional regulator.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF592