ZNF574 Antibody - BSA Free

Western Blot: ZNF574 Antibody [NBP2-88711] - WB Suggested Anti-ZNF574 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: COLO205 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZNF574 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF574. Peptide sequence: ATPTKAPAPVVLGSPVVLGPPVGQARVAVEHSYRKAEEGGEGATVPSAAA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF574
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZNF574 Antibody - BSA Free

• FLJ22059
• FP972
• zinc finger protein 574

Background

ZNF574 belongs to the krueppel C2H2-type zinc-finger protein family and contains 20 C2H2-type zinc fingers. The function of ZNF574 has not been characterized, but due to the presence of the zinc-finger domains is predicted to function in transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF574