ZNF415 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF415 Antibody [NBP1-89466] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & microtubules.
Immunohistochemistry-Paraffin: ZNF415 Antibody [NBP1-89466] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF415 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DRRGIGNKSIKHQLGLSFLPHPHELQQFQAEGKIYECNHVEKSVNHGSSVSPPQIISSTIKTHVSNKYGTDFICSSLLTQEQKSCIREKPYRYIECDKALNHGSHMTVRQVSHSGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF415
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF415 Protein (NBP1-89466PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF415 Antibody

  • MGC126536
  • MGC141923
  • zinc finger protein 287
  • ZKSCAN13Zinc finger protein with KRAB and SCAN domains 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-79358
Species: Hu
Applications: WB
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004188-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00006785-Q01
Species: Hu
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF415 Antibody (NBP1-89466) (0)

There are no publications for ZNF415 Antibody (NBP1-89466).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF415 Antibody (NBP1-89466) (0)

There are no reviews for ZNF415 Antibody (NBP1-89466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF415 Antibody (NBP1-89466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF415 Products

Bioinformatics Tool for ZNF415 Antibody (NBP1-89466)

Discover related pathways, diseases and genes to ZNF415 Antibody (NBP1-89466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF415 Antibody (NBP1-89466)

Discover more about diseases related to ZNF415 Antibody (NBP1-89466).
 

Pathways for ZNF415 Antibody (NBP1-89466)

View related products by pathway.

PTMs for ZNF415 Antibody (NBP1-89466)

Learn more about PTMs related to ZNF415 Antibody (NBP1-89466).

Blogs on ZNF415

There are no specific blogs for ZNF415, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF415 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF415